Please help asap!!!

BEEBOA

New Member
Joined
Jul 14, 2016
Messages
2
I am creating a database of possible protein sequences for a research project that I am working on. I need a way to do this type of formatting for my sequences and cant figure out a way to be able to delete one letter from the right hand side with each new cell:

LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVTHR
LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVTH
LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVT
LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCV
LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATC
LAGLLSRSGGMVKSNFVPTNVGSKAFACNTAT
LAGLLSRSGGMVKSNFVPTNVGSKAFACNTA
LAGLLSRSGGMVKSNFVPTNVGSKAFACNT
LAGLLSRSGGMVKSNFVPTNVGSKAFACN
LAGLLSRSGGMVKSNFVPTNVGSKAFAC
LAGLLSRSGGMVKSNFVPTNVGSKAFA
LAGLLSRSGGMVKSNFVPTNVGSKAF
LAGLLSRSGGMVKSNFVPTNVGSKA
LAGLLSRSGGMVKSNFVPTNVGSK

I have been doing this by hand for one of my proteins of 37 character length, but absolutely cannot do this for more hours with my next 82 character long protein. Any suggestions are helpful! Thank you!!!

<colgroup><col></colgroup><tbody>
</tbody>
 

Excel Facts

Enter current date or time
Ctrl+: enters current time. Ctrl+; enters current date. Use Ctrl+: Ctrl+; Enter for current date & time.

Norie

Well-known Member
Joined
Apr 28, 2004
Messages
76,358
Office Version
  1. 365
Platform
  1. Windows
If you have LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVTHR in A1 put this in A2 and copy down.

=LEFT(A1,LEN(A1)-1)
 
Upvote 0

Forum statistics

Threads
1,186,574
Messages
5,958,586
Members
438,365
Latest member
shikhanep

We've detected that you are using an adblocker.

We have a great community of people providing Excel help here, but the hosting costs are enormous. You can help keep this site running by allowing ads on MrExcel.com.
Allow Ads at MrExcel

Which adblocker are you using?

Disable AdBlock

Follow these easy steps to disable AdBlock

1)Click on the icon in the browser’s toolbar.
2)Click on the icon in the browser’s toolbar.
2)Click on the "Pause on this site" option.
Go back

Disable AdBlock Plus

Follow these easy steps to disable AdBlock Plus

1)Click on the icon in the browser’s toolbar.
2)Click on the toggle to disable it for "mrexcel.com".
Go back

Disable uBlock Origin

Follow these easy steps to disable uBlock Origin

1)Click on the icon in the browser’s toolbar.
2)Click on the "Power" button.
3)Click on the "Refresh" button.
Go back

Disable uBlock

Follow these easy steps to disable uBlock

1)Click on the icon in the browser’s toolbar.
2)Click on the "Power" button.
3)Click on the "Refresh" button.
Go back
Top